Search results

    Congratulations! Your protein is an helicase

    query ['SF2']
    WSKEDFPWSGKVKHVLRDVFKLQKFRPLQLETVNATMARKDIFLVMPTGGGKSLCYQLPA
    LCSDGFTLVICPLISLMEDQLMVLQQLGISATMLNSSSSKEHVKCVHTEMMNKNSHLKLI
    YVTPEKIAKSKMFMSRLEKAYEAGRLTGVAVDEVHCCSQWGHDFRPDYKALGILKRQFPN
    ISLIGLTATATNHVLKDAQKILCVEKCLTFTASFNRPNLYYEVRQKPSSAEDFIENIANL
    INGRYKGKSGIIYCFSQKDSEQVTISLQKLGVRAGTYHANMEPEDRTKVHTQWSANELQV
    VVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDDWRADCILYYGFGDIFRIS
    SMVVMENVGQQKLYEMVSYCQNISKCRRALIAQHFD
    
    • TGGGKSLCYQLPAL [(47, 61)]
    • GVAVDEVHCCS [(147, 158)]
    • LGISATM..IGLTATA [(86, 93), (183, 190)]
    • IIYCFSQK [(250, 258)]
    • VVVATVAFGMGIDKPDVRFV [(299, 319)]
    • SGRAGR [(334, 340)]