Search results


  1. gi|29570448|gb|AAK21428.2| Hypothetical protein K02F3.12a [Caenorhabditis elegans] ['SF2', 'unclassified']
    MATFIFSRGNIFFYVNKITIPDLMSDVLLSKLSTELADLDGEIGQIDQQISQLRRKKSEL
    TQKRQAIERKIELKTNEDSDVVTDRWDRDGFPWSDEATKILKEQFHLEKFRPLQRAAINA
    VMSKEDAVVILSTGGGKSLCYQLPALLANGLALVVSPLISLVEDQILQLRSLGIDSSSLN
    ANTSKEEAKRVEDAITNKDSKFRLLYVTPEKLAKSKKMMNKLEKSLSVGFLKLIAIDEVH
    CCSQWGHDFRTDYSFLNVLKRQFKGVPILGLTATATSNVLDDVKDMLGIQAALTFRAGFN
    RSNLKYKVVQKPGSEDECTEEIAKTIKRDFAGQTGIIYCLSRNDCEKVAKALKSHGIKAK
    HYHAYMEPVDRSGAHQGWISGKIQVIVATVAFGMGIDKPNVRFVIHHSLPKSIENYYQES
    GRAGRDGQPATCILYYRLADIFKQSSMVQQERTGIQNLYNMVRYAADSSTCRRVKLAEHF
    EEAWEPSWCQKQCDTCENGNGFVGTSSKESTDVSEAAKTTVRIIEEHLNSAKDGSGRITG
    NKLVELLTKKLKGSRNREFCEKLIVNLLLEGYLQEDFHYTVYSVISYVVIGSKWRVYNGK
    DAIKMRHVEESKSRKRKASSSVEEEDVMVLD
    
    • TGGGKSLCYQLPAL [(132, 146)]
    • LIAIDEVHCCS [(232, 243)]
    • LGLTATA [(268, 275)]
    • FFYVNKIT..IIYCLSRN [(11, 19), (335, 343)]
    • VIVATVAFGMGIDKPNVRFV [(384, 404)]
    • SGRAGR [(419, 425)]

  2. gi|57227408|gb|AAW43867.1| conserved hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] ['SF2', 'unclassified']
    MSNTAVPIMSNPPIRGAGNRFKRGGFHAARAQANPTRSLATTQPGLIVKTTDSTPVPSGI
    STPAGIDRPRFRDFNGLSPEIFPSLPFETCTEVQAATLPTILAGDDVLAQAKTGTGKTLA
    FLVPVVQRLLSAPMPPSALTSILILSPTRELAQQINEVAERMSTALSKKFGTRSVVGGTN
    MDRDIKNLKSKRADILVATPGRLLDLMENGGIKARFAQLKMIVLDEADRLLDAGFRRELV
    KIFDYLPAPHAVPRQTLLFSATLPTEVHSIASIALRKDYKFITTLTEEDVNAHEHVKQEV
    LVVSAEDLIPAAMEVMRNEESKNKDFKVIAFLPTARAAALFHDVFSSLPIPYPVWEIHSR
    LSQSKRASTTEAFRQAERGVLFSSDVTARGIDVKGVTAVVQIGLPSSSEQYVHRLGRTAR
    AGAEGHGILMLGDFESHFLRDKTLQTFTLHPYPTIAPEIMSRSRDAVNKALEFVSPESKA
    QAYQAWLGYYNSHLKSLRWSQADLVRHAGDYARVSLRNGPQPPGLLAKTVSKMGLRGVPG
    LNIVKEVQKSAGGQDKPHTGKRGRESDITSENTLRGGGRGGGRGGGRGGRGGRGGGGNGR
    GRWQPA
    
    • TGTGKTLAFLVPVV [(112, 126)]
    • MIVLDEADRLL [(220, 231)]
    • LLFSATL [(256, 263)]
    • IAFLPTAR..VLFSSDVT [(328, 336), (379, 387)]
    • VLFSSDVTARGIDVKGVTAV [(379, 399)]
    • GGRGGR..GGRGGR [(584, 590), (587, 593)]

  3. gi|57226705|gb|AAW43165.1| conserved hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] ['SF2', 'unclassified']
    MIIHSSSSNSKKEYTMADDFITTIDSDDEVSNYGEPSALPKIKDDELDPDFQFDLGGGRS
    EGLDLWGGDEVQGVKKGNEPINVDDIIERKRGKPIRAFKDRKRKRDEDATSEDDLEEDEE
    EEGDSNDDSDAAKSGDSEEDEMDVDMSEGDGDEEDENEIESLKREDESDEEEEEEEDDYD
    EEGENEVVDSDSESEEETAAEIARKDAFFSSDPTTTDPTLPSSFTAMNLSRPLLRALTSL
    QFTAPTPIQARAIPLALLGRDILGSAVTGSGKTAAFMVPILERLCYRDRGKGGAACRVLV
    LCPTRELAVQCEAVGKALAEKGGLDVRFALLVGGLSLNAQAHTLRTLPDILIATPGRLID
    HLTNTPSFTLSALDVLVIDEADRMLEAGFTDELEEIIKACPRSRQTMLFSATMTDSVDEL
    VKLSLDKPIRVFVDPKRNTARGLTQEFVRIRSDDSRSPSLLALCKRTIREKCIIFFRSKA
    LAHQMRIVFGLFGLKAAELHGNLTQEQRLQALNDFKAGTVDYLLATDLASRGLDIKGVET
    VINYDMPGQLAQYTHRVGRTARAGRKGRSVSLVGEADRKMLKAAIKQAEADQVRHRIIPS
    EAVTAMKEKLEEFKDDIQEILKEEKEEKLLRQADMEIKKGQNMVEHEAEIFSRPARTWFQ
    SGKEKQASKSAGKDAYVGSFPSTGKSAEKEKEKLKRGKYDGLSRRLKRRKMAIEEDAADA
    AAARKTEMGIRAAKKNALPKKITEPQPRLEKAGKGKDKKKGKARRVTGGKGSAFDSEGKK
    SHEGMRAKPAKVNLEKGKKKGGKGKGRK
    
    • TGSGKTAAFMVPIL [(267, 281)]
    • VLVIDEADRML [(374, 385)]
    • MLFSATM [(406, 413)]
    • AFFSSDPT..LCYRDRGK..MLFSATMT..IIFFRSKA [(206, 214), (283, 291), (406, 414), (472, 480)]
    • YLLATDLASRGLDIKGVETV [(521, 541)]
    • AGRKGR [(562, 568)]

  4. gi|58268036|ref|XP_571174.1| conserved hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] ['SF2', 'unclassified']
    MSNTAVPIMSNPPIRGAGNRFKRGGFHAARAQANPTRSLATTQPGLIVKTTDSTPVPSGI
    STPAGIDRPRFRDFNGLSPEIFPSLPFETCTEVQAATLPTILAGDDVLAQAKTGTGKTLA
    FLVPVVQRLLSAPMPPSALTSILILSPTRELAQQINEVAERMSTALSKKFGTRSVVGGTN
    MDRDIKNLKSKRADILVATPGRLLDLMENGGIKARFAQLKMIVLDEADRLLDAGFRRELV
    KIFDYLPAPHAVPRQTLLFSATLPTEVHSIASIALRKDYKFITTLTEEDVNAHEHVKQEV
    LVVSAEDLIPAAMEVMRNEESKNKDFKVIAFLPTARAAALFHDVFSSLPIPYPVWEIHSR
    LSQSKRASTTEAFRQAERGVLFSSDVTARGIDVKGVTAVVQIGLPSSSEQYVHRLGRTAR
    AGAEGHGILMLGDFESHFLRDKTLQTFTLHPYPTIAPEIMSRSRDAVNKALEFVSPESKA
    QAYQAWLGYYNSHLKSLRWSQADLVRHAGDYARVSLRNGPQPPGLLAKTVSKMGLRGVPG
    LNIVKEVQKSAGGQDKPHTGKRGRESDITSENTLRGGGRGGGRGGGRGGRGGRGGGGNGR
    GRWQPA
    
    • TGTGKTLAFLVPVV [(112, 126)]
    • MIVLDEADRLL [(220, 231)]
    • LLFSATL [(256, 263)]
    • IAFLPTAR..VLFSSDVT [(328, 336), (379, 387)]
    • VLFSSDVTARGIDVKGVTAV [(379, 399)]
    • GGRGGR..GGRGGR [(584, 590), (587, 593)]

  5. gi|58266632|ref|XP_570472.1| conserved hypothetical protein [Cryptococcus neoformans var. neoformans JEC21] ['SF2', 'unclassified']
    MIIHSSSSNSKKEYTMADDFITTIDSDDEVSNYGEPSALPKIKDDELDPDFQFDLGGGRS
    EGLDLWGGDEVQGVKKGNEPINVDDIIERKRGKPIRAFKDRKRKRDEDATSEDDLEEDEE
    EEGDSNDDSDAAKSGDSEEDEMDVDMSEGDGDEEDENEIESLKREDESDEEEEEEEDDYD
    EEGENEVVDSDSESEEETAAEIARKDAFFSSDPTTTDPTLPSSFTAMNLSRPLLRALTSL
    QFTAPTPIQARAIPLALLGRDILGSAVTGSGKTAAFMVPILERLCYRDRGKGGAACRVLV
    LCPTRELAVQCEAVGKALAEKGGLDVRFALLVGGLSLNAQAHTLRTLPDILIATPGRLID
    HLTNTPSFTLSALDVLVIDEADRMLEAGFTDELEEIIKACPRSRQTMLFSATMTDSVDEL
    VKLSLDKPIRVFVDPKRNTARGLTQEFVRIRSDDSRSPSLLALCKRTIREKCIIFFRSKA
    LAHQMRIVFGLFGLKAAELHGNLTQEQRLQALNDFKAGTVDYLLATDLASRGLDIKGVET
    VINYDMPGQLAQYTHRVGRTARAGRKGRSVSLVGEADRKMLKAAIKQAEADQVRHRIIPS
    EAVTAMKEKLEEFKDDIQEILKEEKEEKLLRQADMEIKKGQNMVEHEAEIFSRPARTWFQ
    SGKEKQASKSAGKDAYVGSFPSTGKSAEKEKEKLKRGKYDGLSRRLKRRKMAIEEDAADA
    AAARKTEMGIRAAKKNALPKKITEPQPRLEKAGKGKDKKKGKARRVTGGKGSAFDSEGKK
    SHEGMRAKPAKVNLEKGKKKGGKGKGRK
    
    • TGSGKTAAFMVPIL [(267, 281)]
    • VLVIDEADRML [(374, 385)]
    • MLFSATM [(406, 413)]
    • AFFSSDPT..LCYRDRGK..MLFSATMT..IIFFRSKA [(206, 214), (283, 291), (406, 414), (472, 480)]
    • YLLATDLASRGLDIKGVETV [(521, 541)]
    • AGRKGR [(562, 568)]

  6. gi|54261487|gb|AAH84181.1| Hypothetical LOC496549 [Xenopus tropicalis] ['SF2', 'unclassified']
    MAAFSEMGVMAEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
    IQIVYETLKDQQEGKKGKTSVKTGSTVLNKWQMNPYDRGSSFAIGSDGLCCQSREIKEWH
    GCRSTRGVNKGKYYYEVSCHDQGLCRVGWSTLQASLDLGTDKFGFGFGGTGKKSHNKQFD
    NYGEEFTMHDTIGCYIDIDNGTVKYSKNGKDLGLAFQIPAHLKNQAVFASCVLKNAELKF
    NFGEEDFKFPPKDGFVALSKAPDGHVVKSQNTGSAQVSQAKNLPNAPKALIIEPSRELAE
    QTLNNVKQFKKYVDSPKLRELLIIGGVAAKEQLTLLENGVDIVVGTPGRIDDLISTGKLN
    LSQVRFLVLDEADGLLSQGYSDFINRIHGQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE
    KIMHFPTWVDLKGEDSVPETVHHVVVPVNPKKDKQWERLGKNHIRTDGVHDKDNTRPGGN
    SAEMWSEAIKVLKGEYTVRAIKEHKMDQAIIFCRTKLDCDNMEQYFIQQGGGPDKKGHQF
    SCVCLHSDRKPQERKHNLERFKKCEVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
    HRIGRVGRAERMGLAISLVAAEKEKVWYHVCSSRGKGCHNTRLKEDGGCTIWYNETQLLS
    EIEEHLTCTISQVEPDIKVPLDEFDGKVVYGQRRATGGGLYKGHVDILAPTVQELAALEK
    EAQTSFLHLGYLSNQLFRTF
    
    • TGSGKTGAFSIPVI [(47, 61)]
    • FLVLDEADGLLS [(365, 377)]
    • IVCSATL [(403, 410)]
    • VWYHVCSS..VVYGQRRA [(625, 633), (687, 695)]
    • FLICTDVAARGIDIHGVPYV [(567, 587)]
    • IGRVGR [(602, 608)]

  7. gi|58331968|ref|NP_001011133.1| hypothetical LOC496549 [Xenopus tropicalis] ['SF2', 'unclassified']
    MAAFSEMGVMAEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
    IQIVYETLKDQQEGKKGKTSVKTGSTVLNKWQMNPYDRGSSFAIGSDGLCCQSREIKEWH
    GCRSTRGVNKGKYYYEVSCHDQGLCRVGWSTLQASLDLGTDKFGFGFGGTGKKSHNKQFD
    NYGEEFTMHDTIGCYIDIDNGTVKYSKNGKDLGLAFQIPAHLKNQAVFASCVLKNAELKF
    NFGEEDFKFPPKDGFVALSKAPDGHVVKSQNTGSAQVSQAKNLPNAPKALIIEPSRELAE
    QTLNNVKQFKKYVDSPKLRELLIIGGVAAKEQLTLLENGVDIVVGTPGRIDDLISTGKLN
    LSQVRFLVLDEADGLLSQGYSDFINRIHGQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE
    KIMHFPTWVDLKGEDSVPETVHHVVVPVNPKKDKQWERLGKNHIRTDGVHDKDNTRPGGN
    SAEMWSEAIKVLKGEYTVRAIKEHKMDQAIIFCRTKLDCDNMEQYFIQQGGGPDKKGHQF
    SCVCLHSDRKPQERKHNLERFKKCEVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
    HRIGRVGRAERMGLAISLVAAEKEKVWYHVCSSRGKGCHNTRLKEDGGCTIWYNETQLLS
    EIEEHLTCTISQVEPDIKVPLDEFDGKVVYGQRRATGGGLYKGHVDILAPTVQELAALEK
    EAQTSFLHLGYLSNQLFRTF
    
    • TGSGKTGAFSIPVI [(47, 61)]
    • FLVLDEADGLLS [(365, 377)]
    • IVCSATL [(403, 410)]
    • VWYHVCSS..VVYGQRRA [(625, 633), (687, 695)]
    • FLICTDVAARGIDIHGVPYV [(567, 587)]
    • IGRVGR [(602, 608)]

  8. gi|49086766|ref|XP_405403.1| hypothetical protein AN1266.2 [Aspergillus nidulans FGSC A4] ['SF2', 'unclassified']
    MARHGDTRSPSPVGSTYSSSRRSRRDDDRYERKRDDGRSYRRSRSPERRYRERDRDRDSY
    RRRDHSVDRRDSHRDEDNYRRRDRSRDRRRSRDRDHDRDYRRRSRSRDRDYRSRRDDSRD
    RVRRRTDDSADLKRKSRRDDSRDRTRGAEPKSREASTPAIPTRTGPTDDEKRAERLAKLE
    AWKQKQAAEKERKQKEAEASGGPRNILEEIDRKSGLSPAVSSPQSPATQGVDAAPAAYAG
    KFDPKAIAKNAAQTPAAPSVLGNDVAVPSSAKTSNAQTARVQASKASGNAPSPAVLKAKG
    NVGSFGLGTKQVADNEKSIATKTLGFGEEESTRRKLERLPTPPLDDADASKTAETNADDD
    DDVDMQDGETEEDAAAAARVAAERREERLQNESLTKTTNGNTTAKAEEADKMEVDAQEEE
    LDPLDAFMSELAESAPPKKKAGAKFSKAQEPEAIFGDEHDVSMTAVGEGDAEDFLAIASK
    AKKKKDIPTVDHNKVEYEPFRRKFYTEPSDLAQMSEEEAANLRLELDGIKVRGLDVPKPV
    QKWSQCGLGIQTLDVIDKLGFASLTSIQAQAIPAIMSGRDVIGVAKTGSGKTMAFLIPMF
    RHIKDQRPLENMEGPIGLIMTPTRELATQIHKDCKPFLKALNLRAVCAYGGAPIKDQIAE
    LKRGAEIIVCTPGRMIDLLAANAGRVTNLRRVTYVVLDEADRMFDMGFEPQVMKILSNVR
    PDRQTVLFSATFPRNMEALARKTLTKPIEIVVGGRSVVAPEITQIVEVCNEEKKFVRLLE
    LLGNLYSTDENEDARSLIFVDRQEAADTLLRELMRKGYPCMSIHGGKDQIDRDSTIEDFK
    AGIFPVLIATSVAARGLDVKQLKLVVNYDAPNHLEDYVHRAGRTGRAGNTGTAVTFLTED
    QERYSVDIAKALKQSGQEVPEAVQKLVDSFLEKVKAGKEKASNSGFGGKGLERLDQERDA
    ARMRERRTYKTGEEGEDEEEKDEKKNEQAEEQFNKVLSAVQSTSAQLPGVPKGIDLDGKI
    TVHKREVDPNAPNNPLDKVGSAVADIHARLSRAGVMRSGVPIDNRGPDAGAFHATLEIND
    FPQKARWAVTNRTNVAKILEATGTSITTKGSFYPAGKEPGPGENPKLYILVEGETELSVT
    NAMRELMRLLKEGTIAAVDSESRAPASGRYSVV
    
    • TGSGKTMAFLIPMF [(586, 600)]
    • YVVLDEADRMF [(693, 704)]
    • VLFSATF [(725, 732)]
    • AAYAGKFD..AIFGDEHD..LIFVDRQE [(235, 243), (452, 460), (796, 804)]
    • VLIATSVAARGLDVKQLKLV [(845, 865)]
    • AGRTGR [(880, 886)]

  9. gi|49085758|ref|XP_404975.1| hypothetical protein AN0838.2 [Aspergillus nidulans FGSC A4] ['SF2', 'unclassified']
    MLFRCRDGPGTDRTSQFYGEAENARVFPQEIPDSNYLPGSSHIFSTEIQENAEAEQLRHE
    LFGRLRLYRDSYKKSPKAFPILAETGEYMLLPMPTEEHEGALARIQADRERVAEPVTNFN
    PAKYSDANKKKLKKTRVLKNSWTDPAIVDWEYCPRGLAHSNSDEVAYRARFQNWLENPND
    KVSWPHAHETVAVYCYNINLQERESEEAVEHRKRMELQLRREARREPLCSPRSPVADTYL
    RPVDVNKDTPELREIYNWYTQNSFVSPGVHVIDEDEVRQRIEESRSINLPYIVAIDRRAE
    KILGYALAREFDRHAASYFIAELELYAKDEHTNLGIGRCLLDKLLEICDPTYTPKCGCSF
    RTSKEERSGYYSSGTRRLARLIFTLCYIDMKAEDIFKYKRVKKWLKQHGEFEEQGLLQSI
    RVKNNYLINVAYLDSRCSAWKLQNGGIGEVKFLRWEVVATNHIGPARRLGKAPKRSWKAR
    EKKLGCPNSLIEMAPITKQRPSAKDDDFVLTLSDDENDRFDEPQDEDATSMSSSKKRKRE
    AGENAAPTNKKMKQQQHGKQQKGKKGKQASMEKEARSDDEEEEEQDAGEDDGALDSEFEF
    DVGAVVNQVVEFDGWGGNGEDGEKKNGNKKAVDIDDIIERRREKREKKAEKEKKKKHLDE
    CEDEKDEDEDDAMSVDFGDDELLAKDGFGMGADGVDEEEEEEEEEEEEEETEGNDESDDE
    DEEEGEDDDDDAASDSDSVATPVHHPDDEASEPDSDAESEVDAEEEAKRKAFFAPEEKTD
    EDAATNSAKRSFQEFNLSRPILRGLAAVNFTNPTPIQQKTIPVALLGKDIVGSAVTGSGK
    TAAFVVPILERLLFRPRKVPTSRVAILMPTRELAVQCYNVATKLATYTDITFCQLVGGFS
    LREQENVLKKRPDVIIATPGRFIDHMRNSASFTVDTLEILVLDEADRMLEDGFADELNEI
    LTTIPKSRQTMLFSATMTDSVDKLIRVGLNRPVRLMVDTKKNTAVTLVQEFVRLRPGRED
    KRLGYLLHLCKEVYTGRVIVFFRQKKEAHRVRIVFGLLGLKAAELHGSMSQEQRIKSVES
    FRDGNVNFLLATDLASRGLDIKGVETVINYEAPQSHEIYVHRVGRTARAGRSGRACTIAA
    EPDRKVVKAAVKAGKAQGAKIVSRVVDPSVADDWASKAKDMEEEIDAVLEEEKLEKQLAQ
    AEMQVTKGENLIKHEAEIKSRPKRTWFETEREKRVAKKIGAAELNGPSKKEKVKLSNKDK
    KRLDAAKLRQEEGLGRKKSKAEREDPRAGKAKLGKGKDCYLTKSLGSLPMDSTKSNILVI
    GFGGIGTMTAYNLEAGGRATVTGVLRSNYDLVASRGFRIWSCDHGQVESWRPTSGMNAAR
    PVRNKADMMIVTKAVPDARTMASPFDYIVVCTKNIPDIPPTVAEVIAPAITPRHTSVVLV
    QNGINIEKPIIAAFPENVVISGISLMNSSELRPGEIFHQDHDNLIIGAFRNPNLDIETEC
    RAAKLFTDLYNASEKATGEYSAEVQFMRWRKLVYNASYNSLCAITGMDTSKLRLTHTAVT
    ELLLPVMLEVKSVARAAGYQLAADQEDISLNGDPLYGYFRPSMQQDIEKGNFMEVEVIVG
    EAVREGQRLGVPVPMLSTVYSLLKVLQFRTKVNKGMVELPPMKDFGAGNIVEVSKP
    
    • TGSGKTAAFVVPIL [(835, 849)]
    • ILVLDEADRML [(938, 949)]
    • MLFSATM [(970, 977)]
    • VAYRARFQ..AVYCYNIN..VAYLDSRC..AFFAPEEK..MLFSATMT..IVFFRQKK..VFFRQKKE..LVYNASYN [(164, 172), (191, 199), (429, 437), (770, 778), (970, 978), (1038, 1046), (1039, 1047), (1531, 1539)]
    • FLLATDLASRGLDIKGVETV [(1087, 1107)]
    • AGRSGR [(1128, 1134)]

  10. gi|32422903|ref|XP_331895.1| hypothetical protein [Neurospora crassa] ['SF2', 'unclassified']
    MARLRDSRSPSPAGSLSARKRKDDDRRDRDRRDGPVDHRRRSRSPIDRRYRDRDRDRGRD
    GRDRDSYRRRDRSIDRRDDDYYRGSRRDGDRRRSRDRGLDRLRSPDRRRDRSRDPDREYR
    PRRDDSRDRARVRREGTAESSSHRRDDVRARDQPKPGNTTAKENEPAKSTPTQPQTEAEK
    KAERLRKLQAMKQKHALKEAKEADVTAGLTRKLFMEMDQRASGAVVGSGTNSPAPASPAA
    AESPASPAPYVGKFDPKAIARNAKPARASSPVRLGDVKLGDVKVGAPVAAAASIAGQGKG
    AASGKAGLLQTGRPISTFGFNKSADALKTTAKRKIDMGDEEIIKRKLVKLPDLALENADD
    TPYADDDVAEDAEKDFDVLLAGTEEDRAEAQRLLRERREEQIQKESMAMEIDSAPSNIEV
    ATEPVAQNPTAMDVDDEVDPLDAFMAGLEQTASGEESHSKADTLTEKKNGNIPPEAYFSD
    DDYGYEADGTDPTSILAMASKKKKKDIPTIDYSKLDLNPIRKNFWVEPYELSHMSEEELA
    ELRLELDGIKVSGKNIPKPVQKWSQCGLTRPILDTIESLGFEKPTPIQMQALPVIMSGRD
    VIGVAKTGSGKTMAFALPMLRHVKDQDPVTGDDGAIALIMTPTRELCTQIYSDLQPFAKA
    LKLRVVAAYGGNAIKDQIAELKRGAEIIVATPGRLIDLLAANGGRVTNLKRATYLVLDEA
    DRMFDMGFEPQVMKIFNNVRPDRQTILFSATMPRIIDALTKKVLRDPVEITVGGRSVVAP
    EITQIVEVMDEGKKFNRLLELLGELYADDDDVRSLIFVERQEKADDLLRELLRRGYGCMS
    IHGGKDQEDRNSTISDFKKGVCPILIATSIAARGLDVKQLKLVINYDAPNHLEDYVHRAG
    RTGRAGNTGTAVTFITEEQENCASGIAKALEQSGQPVPDRLNEMRKAWKEKVKAGKAKDA
    SGFGGKGLEKLDKDREAARMRERKTHKAEGEEDDVKEDAPAEDGEKKDKTKVAIQSAVSA
    IVSRDASKAETEDKHAIPAGAVKAGHHASSGKSGGALDKAASAISEINARLARAGQLRPG
    QPIDNKGPDAGAFHATLEINDFPQKARWAVTNRTNVAKILEATGTSITTKGNYYAPGKEP
    GPGQEPKLYILIEGDTEVVVGNALSELTRLLREGTMAAADAESRAPASGRYTIT
    
    • TGSGKTMAFALPML [(606, 620)]
    • YLVLDEADRMF [(713, 724)]
    • ILFSATM [(745, 752)]
    • LIFVERQE [(814, 822)]
    • ILIATSIAARGLDVKQLKLV [(863, 883)]
    • AGRTGR [(898, 904)]

  11. gi|32412764|ref|XP_326862.1| hypothetical protein [Neurospora crassa] ['SF2', 'unclassified']
    MADQLSSGMGNLSIDQQPPSGPQMGGQGQMRRSYIPPHLRGKMGDAAPPMAGPNGLNNSA
    WAGNNNYDARGPGGGGNWPAPGGPPGPGFEGQQGAGWGGPRPQGGFNPNAYRGNAGAGAG
    AGAGGGGGSFSNRGSGDGQWRDGKHIPGPANPRVERELFGTPDDPSKQHTGINFEKYDDI
    PVEASGDNVPEPVLTFSNPPLDNHLISNIQLARYNVPTPVQKYSIPIVMGGRDLMACAQT
    GSGKTGGFLFPILSQSFHTGPSPIPASAAGAYGRQRKAYPTALILAPTRELVSQIYDEAR
    KFAYRSWVRPCVVYGGADIGSQLRQIERGCDLLVATPGRLVDLIERGRISLCNIKYLVLD
    EADRMLDMGFEPQIRRIVEGEDMPKVNDRQTLMFSATFPRDIQILARDFLKDYIFLSVGR
    VGSTSENITQKVEYVEDIDKRSVLLDILHTHAGGLTLIFVETKRMADSLSDFLINQNFPA
    TSIHGDRTQRERERALEMFRNGRCPILVATAVAARGLDIPNVPTYNYDLPTDIDDYVHRI
    GRTGRAGNTGIATAFFNRGNRGVVRELLELLKEANQEVPAFLETIARESSFGGGRGGRGG
    GRGGGRGRTQTADYRKFGGSGGGGFGGGFGGAPASGGYGGGGYGGGGPPAGGYGGGGGAG
    YGGGGGGGGYGGGGYGNPGGAGGQSWW
    
    • TGSGKTGGFLFPIL [(239, 253)]
    • YLVLDEADRML [(355, 366)]
    • LMFSATF [(391, 398)]
    • FAYRSWVR..LIFVETKR [(301, 309), (456, 464)]
    • ILVATAVAARGLDIPNVPTY [(505, 525)]
    • IGRTGR..GGRGGR [(539, 545), (592, 598)]

  12. gi|32412234|ref|XP_326597.1| hypothetical protein [Neurospora crassa] ['SF2', 'unclassified']
    MKAVAGDPNPEFAFEHQSIRPRTTCQTRLSTGQTLQQLAYRNGLTPRTASFSTSGPSHQE
    AAAVAPAPQVSPAPVADMPGVYADMAGRLDARLLKALDAMGYANMTPVQEKVLNMGSFTQ
    DCLVQAKTGTGKTIAFLLPALHTLLNAKDLDPSQVALLILAPTRELAQQIVDECEKLVSQ
    CNPRFECHLAVGGSAKASSLSKFLRGKPTILVATPGRLDDYLSDERVRQKFNNLRCLVLD
    EADCMLDQGFLPALTKILTSLPKKQQAGWQGMCFSATLPPSIHKVLHHVLAPKHAHISTV
    DENEAPTINSVPQSYMKVDSVDDVLPTLHNLLSAERYDNPKLKAVVFCSTARQAALLYTL
    FGHTGGASPAKLPVWQMQSRMNQAQRTRTTEEFKNTDSGILFASDVVGRGLDFPDIHLVI
    QVGIPLNSEQYVHRVGRTGRAGKGGRAVMIITPEDFWFVERNRQFPMAQSKLDHPKAAAV
    DSASIISQSLAKVPDQVKAQAYVAYLGFVNTMRSKMKITPAQMVQVANRYAFSLGCEEPP
    AIEASTIGKMGLKGVPGLIKNTGPSLRGQRNGGNRPNQSAPRGGGRDAGRDAGRDGGRDA
    ARDVDASFFGNGPNGGAPRGGGRGRGGFGGRGRGGPGGAGGDRNSSFKKPRDDSAPPGSS
    GGSRNKRPRREDNRREAF
    
    • TGTGKTIAFLLPAL [(127, 141)]
    • CLVLDEADCML [(235, 246)]
    • MCFSATL [(271, 278)]
    • VVFCSTAR..FWFVERNR [(344, 352), (455, 463)]
    • ILFASDVVGRGLDFPDIHLV [(399, 419)]
    • VGRTGR [(434, 440)]

  13. gi|32410313|ref|XP_325637.1| hypothetical protein [Neurospora crassa] ['SF2', 'unclassified']
    MSSTKKHSRSEGEEKDARLAKKVKTDETPVDGEVKKERKKDKKEKKDKKEKKDKKSKKEK
    KDQDESPATESTEDVSMPDAAAEPVADKKEKKEKKDKKEKKDKKEKKAKKSDESTTEEST
    SASKATTNGTTTPAASTNGAYTYKQADALSALPESEIETFLKEKEIVIKDPSSSNLRPIM
    NFSQLPQSNLISKNPFAAYTNPTPIQSASWPFSLSGRDVIGIAETGSGKTMAFSLPCVES
    LASRPKPKFNSRDRTAHPRAVIVSPTRELAMQTHAALSGLASLVGLSAVCIFGGSDKNEQ
    RNLLYKNNGVDIITATPGRLKDFLSEGSISLANVSFAVLDEADRMLDRGFSEDIKLILSG
    CPPKEQRQTLMFTATWPLDIQKLAESYMINPAQVTIGHRTRAGGDGEGNGNIELQANSRI
    EQKVEVVDPRGKEFRLYELLKEAQKGSQKDDRILVFCLYKKEAVRVEQFLSRKGIKVASI
    HGDLRQDQRTRSLEAFKSGTTTVLVATDVAARGLDIPEVKLVINVTFPLTIEDYVHRIGR
    TGRAGKLGKAITLFTEHDKAHSGSLVNILRAAKQPVPEELLKFGTTVKKKAHDAYGSFYK
    DIDPNKKATKITFD
    
    • TGSGKTMAFSLPCV [(224, 238)]
    • FAVLDEADRML [(335, 346)]
    • LMFTATW [(369, 376)]
    • CIFGGSDK [(289, 297)]
    • VLVATDVAARGLDIPEVKLV [(502, 522)]
    • IGRTGR [(537, 543)]

  14. gi|32409237|ref|XP_325099.1| hypothetical protein [Neurospora crassa] ['SF2', 'unclassified']
    MDIFKVLSRGIKAQPKKNQPGAPQLLPSAGAKVNPQFFHDNVGGANAKRGKKRKRKGAQA
    NNATESGDEDDDASDVDYFAPKPTPEELAAKKDAELKADEPKKQKPKLLEENECRQILKS
    HRLKFTVLAGRVPQDEAATEEKPPKKQKKQKEDRKKQEEEEKKKKKKDEDKKQIYPQPLN
    SFGELKYTYGIHPVLADNITRQGFRVPTEVQMGSLPLQLRPEMALEKATDVEDVKVEKGI
    DFLGVAPTGSGKTISFLIPAIDAIIKRRAEDYTPETDEHVLQAIVVAPTRELASQIVNEG
    RKLAIGTGVRVVLMKRTLRLVAESNEQEETEQEAKEEVQDSDSDSEAESEPEEVMKIDEE
    EEEEEESDSDAEKKTESRAKGDQKFKKERPITRVDILVTTPKILLNFLCGGEKEKGKPRI
    IKKTLPTVQSLILDEADVLLDPIFRKQTMGIWRACTHPNLGMTCWSATMASNIEALLTKH
    IDKRAKRTPEQTPKPLIRLVVGLKDTAVPNITHKLIYTATEPGKLLALRQLLHPVSSADS
    GPPLRPPFLVFTQTIERAQALHDELKYDIPLEAGGSARVAVLHSSLPDSVRSKIMARFRS
    GEVWVLITTDVLARGVDFAGVNGVVNYDVPVSAAAYVHRAGRTGRAGREGGVAVTFYTKD
    DIPFVKSVANVIAMSEKQAGKDIDEKDTVKAAQGSVQKWLLDALPKVAKEDKRKLKVRGV
    ESRRTGGKATITTKSSWERRRENNRREAIEASKRRKREAQKAQKEGGAAPEKAEEEWTGL
    D
    
    • TGSGKTISFLIPAI [(247, 261)]
    • SLILDEADVLL [(429, 440)]
    • TCWSATM [(462, 469)]
    • LVFTQTIE [(548, 556)]
    • VLITTDVLARGVDFAGVNGV [(604, 624)]
    • AGRTGR..TGRAGR [(639, 645), (642, 648)]

  15. gi|32490970|ref|NP_871224.1| hypothetical protein WGLp221 [Wigglesworthia glossinidia endosymbiont of Glossina brevipalpis] ['SF2', 'unclassified']
    MNKKELSFSELGLKDFILLALNDLGYKKPSPIQEKCIPFLLKGYDVLGIAQTGSGKTAAF
    FLPLLNNIDLKLKLPQIIILTPTRELALQIKFACCSLSKYIKEINIIALYGGQNYSIQIK
    SLKRNPQIVVGTPGRILDLLNKKYLNLSEITSFVLDEADEMLRMGFIEDVENIFLKSSKQ
    HQTILFSATMPAAIHRITKRFMKKPKEIRIKASENTRPNIKQNYWIVYGLCKIEALLRFL
    EVEIFDAVIIFVRTKNATLEVSDVLEKNGYNSSSLNGDMNQILREKTLNRFKTGLLDILV
    ATDVAARGLDVDRISLVINYDIPLDVESYIHRIGRTGRAGRTGKALMFVENRERKILYNI
    ERNIKEKLSQIKLPSVELLCKKRLNNFSEKIKNQINSLDLNKYQNLLSKIISFIGISDVK
    IISAALLKVAQKNKPLIISPDNFFNKNKKINLLINKNNKRKKLNIIKNKKKSISLYKAEI
    GKKDGIESKHIVRTMINLGKIKSNDIGSIKIFFNYSTIEIYKKIPLNLLSILSKSTIFKK
    SLNLKLLNHNKISKKPILKKIGSRLSNRISKNTSNKISYNRQI
    
    • TGSGKTAAFFLPLL [(51, 65)]
    • SFVLDEADEML [(151, 162)]
    • ILFSATM [(183, 190)]
    • IIFVRTKN..LMFVENRE..ILYNIERN [(248, 256), (345, 353), (355, 363)]
    • ILVATDVAARGLDVDRISLV [(297, 317)]
    • IGRTGR..TGRAGR [(332, 338), (335, 341)]

  16. gi|3874996|emb|CAB03765.1| Hypothetical protein C46F11.4 [Caenorhabditis elegans] ['SF2', 'unclassified']
    MWRGKYSGGYQNRFVSAKSSGTSSLSDGKSMNNVPPPAALTVGNAPVPPPNRNILLSNRK
    EQEMKKEQEYANLMAYGSTSEKQSRRKRIYDDEYLEGGSDDEKPASSSSKLAADDDDEED
    ELDAFMAGIEKQASSDKKVSEQKEKDRKEGKDTEDPSKKGLGRADIDEEDMQESLFKFME
    EYKEKHENDDEQLEYDEDGNIIWSWKKVIDPLPDIDHSQIQYQKFNKNFYEEHEDIKRLH
    YMDVIRLQNTMNLRVGGLKPPRPVCSFAHFSFDKLLMEAIRKSEYEQPTPIQAMAIPSAL
    SGRDVLGIAKTGSGKTAAYLWPAIVHIMDQPDLKAGEGPVAVIVVPTRELAIQVFQEAKK
    FCKVYNINPICAYGGGSKWEQSNELQNEGAEMVVCTPGRIIDLVKMGATNFLRTTFLVFD
    EADRMFDMGFEAQVKSISDHVRPDRQCLMFSATFKQKVERLARDALVDPVRIVQGEVGEA
    NADIEQKVFVMQNQDVKLHWLIRNLVEFASLGKVLIFVTKKLDSEDVAKKLKMKDFDIVL
    LHGDMLQAERNENLLKFRKKSQILVATDVAARGLDISEIRTVINFDMARDIDTHVHRIGR
    TGRAGHKGTAYTLVTEKDIEMVGHLVKNLESVSQEVPKPLMDLAMKSSWFRGQRAGNGGP
    STGTQTRGRMGLGYTPKVRQVGGGATGAQFDPLKEQKSCRGGGNQTVDGMIRNAQSFATS
    SSSSSSSSSGPASGANRAQMLKSAFQKSFQTTFQRPTNESSNLPQQVASDPRPEWKKKVD
    ELNAKIAQQQASSASGGSSSSSSSSKRSRWE
    
    • TGSGKTAAYLWPAI [(310, 324)]
    • FLVFDEADRMF [(415, 426)]
    • LMFSATF [(447, 454)]
    • MAYGSTSE..LVFDEADR..LMFSATFK [(73, 81), (416, 424), (447, 455)]
    • ILVATDVAARGLDISEIRTV [(562, 582)]
    • IGRTGR [(597, 603)]

  17. gi|15887415|ref|NP_353096.1| hypothetical protein AGR_C_92 [Agrobacterium tumefaciens str. C58] ['SF2', 'RecQ-like']
    MNADPLNILKAVYGYDAFRGRQGEIIQHVVAGNNAFVLMPTGGGKSLCYQIPALAREGMG
    LVVSPLIALMVDQVAALRQAGVRAEALNSDLSPEERRTLWRDVRAGNVDILYAAPETLLK
    PDVLDALQSIDLSLIAVDEAHCLSQWGHDFRPPYRQLDMLIARFPNTPRMALTATADEPT
    RAEILGHLAIDEADAFIAGFDRPNIRYAIMEKDNPRTQLKRFLNGRENESGIVYCLSKRK
    VEETAAWLREEGRDALPYHAGMDKAAREENQTRFQHGEAVIIVATVAFGMGIDKPDVRFV
    VHIDLPGSIEAYYQETGRAGRDGLPSDVLMLYGYEDIALRNRFIEESDAADQRKYMERQK
    LDALLGLAETAGCRRQVLLSYFGDRCEPCGNCDTCSSPPDLFEGAIAAQKLLSCIYRTGE
    RFGQAYVISVLLGAQDERITKFGHDSITTYGIGKEHDNRTWRAILRQLVALRLIEVDLSG
    HGGLSISENGRRFLREKPSLMLRIPSAPRSTRRDAPRNAMSTALPEADRGLFEALRAKRM
    EIARAQNVPPYVIFHDKTLIELAAARPASAKEMAQIAGVGQTKLERYGPAFLDTIMQHAA
    GE
    
    • TGGGKSLCYQIPAL [(40, 54)]
    • LIAVDEAHCLS [(133, 144)]
    • MALTATA [(169, 176)]
    • IVYCLSKR [(231, 239)]
    • IIVATVAFGMGIDKPDVRFV [(280, 300)]
    • TGRAGR [(315, 321)]

  18. gi|56403752|emb|CAI29665.1| hypothetical protein [Pongo pygmaeus] ['SF2', 'unclassified']
    MAAFSEMGVMPEIAQAVEEMDWLLPTDIQAESIPLILGGGDVLMAAETGSGKTGAFSIPV
    IQIVYETLKDQQEGKKGKTTIKTGASVLNKWQMNPYDRGSAFAIGSDGLCCQSREVKEWH
    GCRATKGLMKGKHYYEVSCHDQGLCRVGWSTMQASLDLGTDKFGFGFGGTGKKSHNKQFD
    NYGEEFTMHDTIGCYLDIDKGHVKFSKNGKDLGLAFEIPPHMKNQALFPACVLKNAELKF
    NFGEEEFKFPPKDGFVALSKAPDGYIVKSQHSGNAQVTQTKFLPNAPKALIVEPSRELAE
    QTLNNIKQFKKYIDNPKLRELLIIGGVAARDQLSVLENGVDIVVGTPGRLDDLVSTGKLN
    LSQVRFLVLDEADGLLSQGYSDFINRMHNQIPQVTSDGKRLQVIVCSATLHSFDVKKLSE
    KIMHFPTWVDLKGEDSVPDTVHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGAN
    SPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQF
    SCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYV
    HRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLS
    EIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKRAAGGGSYKGHVDILAPTVQGLAALEK
    EAQTSFLHLGYLPNQLFRTS
    
    • TGSGKTGAFSIPVI [(47, 61)]
    • FLVLDEADGLLS [(365, 377)]
    • IVCSATL [(403, 410)]
    • VWYHVCSS [(625, 633)]
    • FLICTDVAARGIDIHGVPYV [(567, 587)]
    • IGRVGR [(602, 608)]

  19. gi|53750674|emb|CAH12081.1| hypothetical protein [Legionella pneumophila str. Paris] ['SF2', 'RecQ-like']
    MGTLAQPSFINPNALAVLKKYFGFDSFRPPQEKIIEDVISGEDVLVLMPTGGGKSLCYQI
    PAIVRPGVGIVVSPLIALMEDQVTALKLQGIRAAYYNSSLTAEEARNVLNQLHHNELDLL
    YIAPERLISTSFLDRLSECTISLFAIDEAHCISQWGHDFRPEYACLGLLKTNFPDIPMIA
    LTATADKQTREDIVTKLNYQPKKYVVSFNRPNIHYKVVPKTNAVKQLNLFLQSDTQQSGI
    IYCGTRHTVEHLTAKLQELGFKARAYHAGLPHAVRREVQNLFRYDRIDIVVATIAFGMGI
    DKPNVRFVVHHDLPKSIEGYYQETGRAGRDGLPAKALLLYDAADSARLRSWIMNIPLEEQ
    RHIETNKLNHMLAFAEASHCRRQILLRYFDEPSHTECKNCDVCDNPPQTADATEDAQKFL
    SCIYRLKQSYGLTHTIDVLRGSLSEKIKQSGHEHLSTFGIGKEKSANYWKHLAWQLIHKD
    YCLQDMNHFNVLRLTPKAIPLLKGEESISLTIPNNDLNSSKKKGKQNPSFKPESNPLFEK
    LRALRRQLADEENKPPFMIFSDATLHEMAQSKPKNSKQLLNVSGVGQHKLARYGHYFLEA
    LNEFSEVE
    
    • TGGGKSLCYQIPAI [(49, 63)]
    • LFAIDEAHCIS [(142, 153)]
    • IALTATA [(178, 185)]
    • IIYCGTRH..LLYDAADS..LAFAEASH..CIYRLKQS [(239, 247), (337, 345), (371, 379), (421, 429)]
    • IVVATIAFGMGIDKPNVRFV [(288, 308)]
    • TGRAGR [(323, 329)]

  20. gi|53750076|emb|CAH11468.1| hypothetical protein [Legionella pneumophila str. Paris] ['SF2', 'unclassified']
    MSFKQLALIEPLNRAVSELGYTNPTSIQLKAIPLILNGHDLLGSAQTGTGKTASFVLPIL
    QKASQQTQTSRNRAKVLILTPTRELAIQAHESIIQYGKYLTLRSAVIYGGVKSHNQIKQL
    DSGLEILVATPGRLLDLYQQGAVKFDEIDTLVLDEADRMLDMGFIHDIKKIIKLLPLKRQ
    NLLFSATFTPEVRTLARNILNKAVEIDIAPRNTAVKTIKQTVYSVDGNHKLALLSHLLHK
    NNWGQTLVFSRTKHGANKLVKQLAESQIYSVAIHGNKSQAQRTKALADFKSGKVQTLIAT
    DIAARGIDIEKLACVVNFDLPHVPEDYVHRIGRTGRAGASGLAVSLVSTEEIKLLLSIEK
    LINQKLERIKIKDFEFLHNFSDLVSAKIQKFAPPKAGYKGNISRKSRTAFNKSA
    
    • TGTGKTASFVLPIL [(46, 60)]
    • TLVLDEADRML [(149, 160)]
    • LLFSATF [(181, 188)]
    • LLFSATFT..LVFSRTKH [(181, 189), (246, 254)]
    • TLIATDIAARGIDIEKLACV [(295, 315)]
    • IGRTGR [(330, 336)]

  21. gi|14574202|gb|AAK68387.1|AF045641_2 Hypothetical protein F53H1.1b [Caenorhabditis elegans] ['SF2', 'unclassified']
    MGRGEHKEHKRKRSRSKERKRSRSRSPRGSREHREHRDRDRDRERRRERDTDREKTRDRE
    KQRDAEKKKEKESKTAIFEMEESRNDTEEVMKMKEAELLQGVERRRRNVEKWRAQKKKEE
    LDLQSEQSDEKSEKKPWNLEDEDDEDEFDIKNEGISEENPVKMEEKVEKMDTDDEEDPLD
    AFMKEIATKNAKKTGNSTQKASGIVTIVQEEKPEPEKGQVLENEDNMDMVIDDFDIETAA
    ASLCHKGRMLAQTDHSKVYYRKFKKNFYIETEEIRRMTKAEVKAYREELDSITVKGIDCP
    KPIKTWAQCGVNLKMMNVLKKFEYSKPTSIQAQAIPSIMSGRDVIGIAKTGSGKTLAFLL
    PMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKFAKPLGLKVACTYGGVGISEQ
    IADLKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVN
    NIRPDKQTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICAEHQKFLK
    LLELLGMYYEEGSSIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKT
    GVIKVLVATSVAARGLDVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFVLPEH
    QEKMAGEICRAFETAGCKPPADLKAMFERFKSEMAAEGKEVKLGGKGFEGSGYKYDEGEA
    EADANKKRMTRLTAQLQRGGTQARYKV
    
    • TGSGKTLAFLLPMF [(349, 363)]
    • YLVLDEADRMF [(456, 467)]
    • VLFSATF [(488, 495)]
    • AIFEMEES..IVFVDKQE [(75, 83), (554, 562)]
    • VLVATSVAARGLDVKNLILV [(604, 624)]
    • VGRTGR..TGRAGR [(639, 645), (642, 648)]

  22. gi|14574201|gb|AAK68386.1|AF045641_1 Hypothetical protein F53H1.1a [Caenorhabditis elegans] ['SF2', 'unclassified']
    MGRGEHKEHKRKRSRSKERKRSRSRSPRGSREHREHRDRDRDRERRRERDTDREKTRDRE
    KQRDAEKKKEKESKTAIFEMEESRNDTEEVMKMKEAELLQGVERRRRNVEKWRAQKKKEE
    LDLQSEQSDEKSEKKPWNLEDEDDEDEFDIKNEGISEENPVKMEEKVEKMDTDDEEDPLD
    AFMKEIATKNAKKTGNSTQKASGIVTIVQEEKPEPEKGQVLENEDNMDMVIDDFDIETAA
    ASLCHKGRMLAQTDHSKVYYRKFKKNFYIETEEIRRMTKAEVKAYREELDSITVKGIDCP
    KPIKTWAQCGVNLKMMNVLKKFEYSKPTSIQAQAIPSIMSGRDVIGIAKTGSGKTLAFLL
    PMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKFAKPLGLKVACTYGGVGISEQ
    IADLKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVN
    NIRPDKQTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICAEHQKFLK
    LLELLGMYYEEGSSIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKT
    GVIKVLVATSVAARGLDVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFVLPEH
    QEKMAGEICRAFETAGCKPPADLKAMFERFKSEMAAEGKEVKLGGKGFEGSGYKYDEGEA
    EADANKKRMTRLVHGMEAGGDDDDDLEEQLSSMIKTKRRVVHGKPQSEKPSSSSGNAKND
    REAGKRADQAKLKAEELSTRLKGASQVVQPVEKTAAQLTAEAVLRGAEVAPAQMSAAMLA
    KEKANRLNEKLNYLGGEAAPTQQQEEAWEYFEEEWDINDFPQQVRYKICSRESVGHVAEL
    AEVGISVRGVHVPPGKEPKNGERRLHLLLEARSERNLKAAKEEIIRIMKEAFRQLTAQLQ
    RGGTQARYKV
    
    • TGSGKTLAFLLPMF [(349, 363)]
    • YLVLDEADRMF [(456, 467)]
    • VLFSATF [(488, 495)]
    • AIFEMEES..IVFVDKQE [(75, 83), (554, 562)]
    • VLVATSVAARGLDVKNLILV [(604, 624)]
    • VGRTGR..TGRAGR [(639, 645), (642, 648)]

  23. gi|16078982|ref|NP_389803.1| hypothetical protein BSU19220 [Bacillus subtilis subsp. subtilis str. 168] ['SF2', 'unclassified']
    MLHRAQSLLAHYFGYEKFRSGQDEAIRLVTEARQNTACIMPTGGGKSICYQIPALMFEGT
    TIVISPLISLMKDQVDALEEAGINAAYINSTQSNQEIYERLNGLKEGAYKLFYITPERLT
    SIEFIRILQGIDVPLVAIDEAHCISQWGHDFRPSYRNIEILFRELHDKPVIMALTATATP
    EVHDDICKQLHIQKENTVYTGFSRENLTFKVVKGENKDRFIDEYVQNNRHEAGIVYTATR
    KEADRIYERLKRNQVRAGRYHGGLADDVRKEQQERFLNDELQVMVATSAFGMGIDKSNIR
    FVLHAQIPKDMESYYQEAGRAGRDGLASECVLLFSPQDIMVQRFLIEQSEHEEKQKQDLK
    KLRQMVDYCHTEDCLQRFILMYFGEKEPDACGQCGNCTDTRAAHDVTREAQMVLSCIIRM
    KERFGKTMVAQVLAGSKNKKVLENGFSDLSTYGILKHQSVGEISDFIEFLISDDFIRMSD
    GTFPTLFVSSKGRNVLKGELSVARKEALKAAAITENDELFERLRMVRKEIAAEQGVPPFV
    VFSDQTLKEMSGKQPVNDDELLSIKGVGEQKRAKYGRLFLQEIQAYARMTD
    
    • TGGGKSICYQIPAL [(41, 55)]
    • LVAIDEAHCIS [(134, 145)]
    • MALTATA..LTATATP [(171, 178), (173, 180)]
    • AAYINSTQ..IVYTATRK..LMYFGEKE [(84, 92), (233, 241), (379, 387)]
    • VMVATSAFGMGIDKSNIRFV [(282, 302)]
    • AGRAGR [(317, 323)]

  24. gi|54296889|ref|YP_123258.1| hypothetical protein lpp0930 [Legionella pneumophila str. Paris] ['SF2', 'RecQ-like']
    MGTLAQPSFINPNALAVLKKYFGFDSFRPPQEKIIEDVISGEDVLVLMPTGGGKSLCYQI
    PAIVRPGVGIVVSPLIALMEDQVTALKLQGIRAAYYNSSLTAEEARNVLNQLHHNELDLL
    YIAPERLISTSFLDRLSECTISLFAIDEAHCISQWGHDFRPEYACLGLLKTNFPDIPMIA
    LTATADKQTREDIVTKLNYQPKKYVVSFNRPNIHYKVVPKTNAVKQLNLFLQSDTQQSGI
    IYCGTRHTVEHLTAKLQELGFKARAYHAGLPHAVRREVQNLFRYDRIDIVVATIAFGMGI
    DKPNVRFVVHHDLPKSIEGYYQETGRAGRDGLPAKALLLYDAADSARLRSWIMNIPLEEQ
    RHIETNKLNHMLAFAEASHCRRQILLRYFDEPSHTECKNCDVCDNPPQTADATEDAQKFL
    SCIYRLKQSYGLTHTIDVLRGSLSEKIKQSGHEHLSTFGIGKEKSANYWKHLAWQLIHKD
    YCLQDMNHFNVLRLTPKAIPLLKGEESISLTIPNNDLNSSKKKGKQNPSFKPESNPLFEK
    LRALRRQLADEENKPPFMIFSDATLHEMAQSKPKNSKQLLNVSGVGQHKLARYGHYFLEA
    LNEFSEVE
    
    • TGGGKSLCYQIPAI [(49, 63)]
    • LFAIDEAHCIS [(142, 153)]
    • IALTATA [(178, 185)]
    • IIYCGTRH..LLYDAADS..LAFAEASH..CIYRLKQS [(239, 247), (337, 345), (371, 379), (421, 429)]
    • IVVATIAFGMGIDKPNVRFV [(288, 308)]
    • TGRAGR [(323, 329)]

  25. gi|54296291|ref|YP_122660.1| hypothetical protein lpp0320 [Legionella pneumophila str. Paris] ['SF2', 'unclassified']
    MSFKQLALIEPLNRAVSELGYTNPTSIQLKAIPLILNGHDLLGSAQTGTGKTASFVLPIL
    QKASQQTQTSRNRAKVLILTPTRELAIQAHESIIQYGKYLTLRSAVIYGGVKSHNQIKQL
    DSGLEILVATPGRLLDLYQQGAVKFDEIDTLVLDEADRMLDMGFIHDIKKIIKLLPLKRQ
    NLLFSATFTPEVRTLARNILNKAVEIDIAPRNTAVKTIKQTVYSVDGNHKLALLSHLLHK
    NNWGQTLVFSRTKHGANKLVKQLAESQIYSVAIHGNKSQAQRTKALADFKSGKVQTLIAT
    DIAARGIDIEKLACVVNFDLPHVPEDYVHRIGRTGRAGASGLAVSLVSTEEIKLLLSIEK
    LINQKLERIKIKDFEFLHNFSDLVSAKIQKFAPPKAGYKGNISRKSRTAFNKSA
    
    • TGTGKTASFVLPIL [(46, 60)]
    • TLVLDEADRML [(149, 160)]
    • LLFSATF [(181, 188)]
    • LLFSATFT..LVFSRTKH [(181, 189), (246, 254)]
    • TLIATDIAARGIDIEKLACV [(295, 315)]
    • IGRTGR [(330, 336)]

  26. gi|54295408|ref|YP_127823.1| hypothetical protein lpl2494 [Legionella pneumophila str. Lens] ['SF2', 'unclassified']
    MNKEYFSKLLPQIAERSGSAALSRLGFSHVPLYRHLKQQFSRPFGEVGSFLADPSFEATF
    GWEIAKLKMCDLANTLLTTDLVRAMDQPPKELAKDYRFASNLYPYMHQLESWQILANEIP
    QSLVVASGTGSGKTECFMVPILDRLTRLHQEQKSRLIGVRALFLYPLNALINSQRERLRA
    WTYVYGENLRFCLFNGNTPNKIPAHLKQEYPSEVMDRDSLRASPPPILVTNATMLEYMLV
    RTDDAPILEKSQGKLEWVVLDEAHTYIGSQAAELSLLIRRVLHAFGVSPDTVRFVATSAT
    IGDPNGEAGEKLKCFLADVAGVSLDRVHLVSGKRHIPLLPPEEIYTNSLEELSVLSDSDT
    SKDLYNILARHKTARDIRSSFIESEKKNKEKGGSGMVARLSDVCRNIFGNSDWFTLEQQI
    NALRWLDLLSGTCDKNHSAFLPLRAHLFHQTISGIWACADPNCNEKCGSKLEDKEWPFGQ
    IYFEMRKHCRCGSPIYELVACDDCGTPHLIAAQRGDQLVPPINIKVIDEFELDIDANEEE
    LNQDDTNVVNDRYNDAESSVLIVNRNINGVIEEVIDKQTRQLIEPTSGNEHLRLRVLGDS
    GSGLICPCCQGGSHGNRHRKLFQEARIGAPFSLGIILPSLLEFAPDGDDPAEHPYRGRRL
    LTFNDSRQGTARIAAKLQQESERDRIRGLVYHLALRDGLMQSDFEAKQLKDEIQELENIR
    EHVKEEGKTHIENLLVNRKKQLASLSKPKPISFEEMSQKLTNQSSDFERMLSHYRNDISY
    ENFKGPEGSLSLARMFLIREFGRRPKRLNNLESMGLVSVQYPALNNITRAHEGFNLIDWI
    SFLKIALDFFVRAGGSLEIPEKIKSWLGMPFPQTRLVDQDRVDKEKTDRRWPRAYYTLPN
    GNKRLNYQSTLVRILACALKVDIETSLGADKVDAALTSAWRALTEGSGILYSNSGGRRVL
    PLSQIAFTPITNAWICPLTRRFLDTTIQDITPYLPLHYTNETVKCQKIEIPLYDQPFGGD
    ASDLAQVIRARDWLSKQESIIQFKEEGLWPVLNDRAIELSPYFVTAEHSAQQPAYRLDRY
    EKAFKSGDLNLLSCSTTMEMGIDIGGIATVAMNNVPPHPANYLQRAGRAGRRQEARSISL
    TLCKSNPHDQLVFSKTDWPFVTALPAPAVSLNSELIIQRHVNSLILKHFFSTQITGSEQD
    VLKLTCGWFFISEDNNSFAERFIAWCIAFNDANSRLLDGIRQLVRRSRYEGVDAKILIRE
    SGKMMHNLYTSWFKEWDALERQKINMKCLGVNSPAYKAVQNQLDRTTGEYLLKELATGGF
    LPAYGFPTHITVFDNLTISQIKRNKLEKEKIKDREDNNYRHRELASRDRITALREYAPGA
    EVVMDGLVYRSAGITLNWKIPATEKEAQEIQAIRYAWHCDKCNHSGSSLLLDETRFCLEC
    GTKIKLDDPKYHKTFIEPAGFAVDFLMDPDNDVSTQDFIPVELPWVSANGEWISLPNPAL
    GRYRVTTRGHMFYQSSGLHGKGYAICLACGRAEPMVDENIPNKLQSHYKLRGGNDQNEKS
    KICIGSHENWAIKPGITLGHQCYTDVLEIQLKSELGIWIKDKEITMTLAVALRSALADLI
    GIQTTELGCDVKSARTEDNSICRSILIFDRYAAGYSSSASQYIENLFRKARNNLNCPVDC
    DSACPSCILDFDQRFVSESLNRLTALEVITENWLSTLRLPERYQFFGVNSRVECSNVVEA
    VLRTSRKFPESNITLFAGGAGDELDFGASNLRNLIYQIAASNRSVSLVIEKDSLSSMDMV
    ERHLLAGLIEYPGRKISLHTVTELPKTKDAIILAEICIKGQTYRWGVNERSAINMGLLWG
    NTDGPLIVGNKLEPLNLKLESLLVEQLRLSDSTLGDIEIEILKDLDGSLQGFGQRFWKLV
    SSSSPNVASLFSNTSLDIEAISYHDRYLFSPLPVALLLELITGIRTLVGTSRWNNPFIEI
    TTNNESANLNKRSCFIWDNWLDLEARNGAIINSLDYLGIEGKIKLLDKNKSLHGRMLEVK
    FSSNYVLTVRLDQGVSYWKANNYSKQKIFNFGDPDLSNQGIQLAELNVDIESNYFPTHVF
    IKVRQQ
    
    • TGSGKTECFMVPIL [(128, 142)]
    • WVVLDEAHTYIG..GGAGDELDFGAS [(256, 268), (1757, 1769)]
    • VATSATI [(294, 301)]
    • LVYHLALR..LVFSKTDW..WFFISEDN..IAFNDANS..LIYQIAAS [(688, 696), (1150, 1158), (1207, 1215), (1226, 1234), (1773, 1781)]
    • LLSCSTTMEMGIDIGGIATV [(1090, 1110)]
    • AGRAGR [(1125, 1131)]

  27. gi|54293843|ref|YP_126258.1| hypothetical protein lpl0899 [Legionella pneumophila str. Lens] ['SF2', 'RecQ-like']
    MGTLAQPSFINPNALAVLKKYFGFDSFRSPQEKIIEDVISGEDVLVLMPTGGGKSLCYQI
    PAIVRPGVGIVVSPLIALMEDQVTALKLQGIRAAYYNSSLTAEEARNVLNQLHHNELDLL
    YIAPERLISTSFLDRLSECTISLFAIDEAHCISQWGHDFRPEYACLGLLKTNFPDIPMIA
    LTATADKQTREDIVTKLNYQPKKYVVSFNRPNIHYKVVPKTNAVKQLNLFLQSDTQQSGI
    IYCGTRHTVEHLTAKLQELGFKARAYHAGLPHADRREVQNLFRYDRIDIVVATIAFGMGI
    DKPNVRFVVHHDLPKSIEGYYQETGRAGRDGLPAKALLLYDAADSARLRSWIMNIPLDEQ
    RHIETNKLNHMLAFAEASHCRRQILLRYFDEPSHTECKNCDVCDNPPQTADATEDAQKFL
    SCIYRLKQSYGLTHTIDVLRGSLSEKIKQSGHEHLSTFGIGKEKSANYWKHLAWQLIHKD
    YCLQDMNHFNVLRLTPKAIPLLKGEESISLTIPNNDLNSSKEKGKQNPSFKPESNPLFEK
    LRSLRRQLADEENKPPFMIFSDATLHEMAQSKPKNSKQLLNVSGVGQHKLARYGHYFLEA
    LNEFSEVE
    
    • TGGGKSLCYQIPAI [(49, 63)]
    • LFAIDEAHCIS [(142, 153)]
    • IALTATA [(178, 185)]
    • IIYCGTRH..LLYDAADS..LAFAEASH..CIYRLKQS [(239, 247), (337, 345), (371, 379), (421, 429)]
    • IVVATIAFGMGIDKPNVRFV [(288, 308)]
    • TGRAGR [(323, 329)]

  28. gi|54293256|ref|YP_125671.1| hypothetical protein lpl0304 [Legionella pneumophila str. Lens] ['SF2', 'unclassified']
    MSFKQLALIEPLNRAVSELGYTTPTSIQLKAIPLILNGHDLLGSAQTGTGKTASFVLPIL
    QKAGQQTPASPNRVKVLILTPTRELAIQVHESIIQYGKYLTLRSAVIYGGVKSHNQIKQL
    DSGLEILVATPGRLLDLYQQRAVKFDEIDTLVLDEADRMLDMGFIHDIKKIIKLLPLKRQ
    NLLFSATFTPEVRTLARNILNKAVEIDIAPRNTAVKTIKQTVYSVDRNHKLALLSHLLHK
    NNWGQTLVFSRTKHGANKLVKQLAESQIYSVAIHGNKSQAQRTKALADFKSGKVQTLIAT
    DIAARGIDIEKLACVVNFDLPHVPEDYVHRIGRTGRAGASGLAVSLVSTEEIKLLLSIEK
    LINQKLERIKIKDFEFLHNFSDLVSAKIQKFAPPKAGYKGNISRKSRTAFNKSA
    
    • TGTGKTASFVLPIL [(46, 60)]
    • TLVLDEADRML [(149, 160)]
    • LLFSATF [(181, 188)]
    • LLFSATFT..LVFSRTKH [(181, 189), (246, 254)]
    • TLIATDIAARGIDIEKLACV [(295, 315)]
    • IGRTGR [(330, 336)]

  29. gi|16604195|gb|AAF59610.3| Hypothetical protein Y55F3BR.1 [Caenorhabditis elegans] ['SF2', 'unclassified']
    MTAFEEFGIIPELSDALSSLNWTLPTAVQSEAIPAILGGADALIAAETGSGKTGAFSLPI
    AQIVWERRKSAEKSQNSGQKPENSREFQLNREDRDVSLQIDKTGLNCESRVAKEWHGARA
    TAGLYGNGKYYYEVTVTRDGLCRVGWATLSGSLKIGTDFESFGYGGTGKKSFGKKFDDYG
    TSFTTNDVLGCFLDLDELKIWWSKNGVQFPVAYQIDKKFKTAATCLYPAILCQNSGLGVN
    FGGSAAFKYPPGTQYVAVAQAEDGNLKWWSAAEQLSIDSSTPLCVILEPTRELVQQTFQN
    IQTFASVLDSPKIRCVTLAAGENMNQILRTLETGCDIVVGTPSRVFDLIHTGKLATKNLQ
    FVVIDEIDQFLAGKNNCAHQIESIFRVLPLVAQDGTRRQVIACSATLHNFEVCRFADRHM
    SFPQWIDLKGADCVSADVHHVVCHVDASEDKQWIRQMHQQVHLEDDHVHDGDQIRPGTTD
    KDTISLGTKILKGIYVVRAIHALQMDKAIVFCRTKQQCDHMEHFLQQNNLSAACLHGDRS
    AEERQSSLEGFKKGIIRFLVCSDVVARGLDVQGVPFVISVTLPDEKSMYVHRIGRVGRAE
    RMGLSISLVSEYEEKAWYHKCRSRGVNCTNTKDISKGGCTIWLQEKKMLGEIEEHLGATI
    STVDSDFNVPVDEFDGKVVYGERRTGGANFDTHVLQLASSASQLADLETKMQLEYLNNNR
    HVFEIHSM
    
    • TGSGKTGAFSLPIA [(47, 61)]
    • FVVIDEIDQFLA [(360, 372)]
    • IACSATL [(400, 407)]
    • VAYQIDKK..IVFCRTKQ..AWYHKCRS..VVYGERRT [(210, 218), (508, 516), (615, 623), (677, 685)]
    • WATLSGSLKIGTDFESFGYG..FLVCSDVVARGLDVQGVPFV [(145, 165), (557, 577)]
    • IGRVGR [(592, 598)]

  30. gi|32406968|ref|XP_324090.1| hypothetical protein [Neurospora crassa] ['SF1', 'unclassified']
    MSPSAPPKHSILDSLNNAQARAVTSDAATVAILAGPGSGKTHTLTSRVVWLVDHVGYQPQ
    DVVVATFTVKAAREMKERIGKALGNGRENKIILGTFHSIARRYLAAYGRHIGLSEKFSIA
    DDNDSRSIITRICKRLQLGLDPPMAKAWISKKKAKGMEPSPSSLPQPPKKQPVQRGQRDL
    EVCYTEYQTHLERSNLLDYDDLLVRCVELLRKFPSCVSNIQTVLIDEYQDTNGVQYELMR
    LLAQKHQRITIVGDPDQSIYGWRSAEIKNLWRLLRDYPKTDEISLEENYRSSQAILDLSL
    LVIQQDKKRYQKVLKPVHDRGSRPVLRKLKNASTEAEWIVAEIRRALLMSGSMLTHNDVA
    VLLRSASLSRHVESALGKAGIPYRMVGGFKFYERSEIKTILDYLRVIHQPDNNDAFGRIM
    NVPKRGIGDGTIKNLIEEAEKSSLSLYSLLVKHCRGDRTAKTKITKHAEQKISGELIRML
    NGIRKKMEEAAESNPFGLVDLIEHLLTALNFQNYLQVTYPDDHEQRWANVQEFISLANDF
    VRDLHVSGEDALPEIEGLEQSKEEEVLPQFLANVSLASDAQKGEEGQENKPLVTISTIHA
    AKGLEWPIVFIPAVYNGSIPHMRSEDGDEERRLLYVAMTRAQSLLYLSYPVYHSPGSSER
    TEMSSFVSPVANSFAKKGPTFERPLMTHIAKVLQRELPSEKEIFKGIPNMSHTEDNMYPI
    DPDDAFQESGQGFDSSRSKRPKLYNPVAISTGDGHEEPQWAKPHATTMDQASTFTIASLP
    GFVNAAVHQAAITAAANASAAAALEARANKASASSGIKRGTNKRPADQKSILGFVKTNFE
    PATGVGSSITSASTTTNRPSVPTPRLPQPALSRNPSLPLNHSHSPPAHTFTGAGSLQRAQ
    SHPSKPSVPATTAGIAPELASHRLGSSRGLNLNVTRPPSLQPPKDASSTSSFHYKKQYVC
    FSSSPTRPEPDDGISAPPKSAGGGDEEEAEETEQPPTPTRPAGSLHVTTCHNVLPTGLGG
    YPGKRAARGGAVGVVRKPVGLARLDGTEGMGAIKPMERLMKPFKPLTMNRTAGGSGVGGG
    SGRGSGSGNGSTMGRPGLQRPGIGR
    
    • VAILAGPGSGKTHTL [(29, 44)]
    • VLIDEYQDT [(222, 231)]
    • TIVGDPDQSIYGWR [(249, 263)]
    • ISLEENYRS [(282, 291)]
    • TIHAAKGLEWPIV [(596, 609)]
    • EERRLLYVAMTR [(628, 640)]

  31. gi|19552081|ref|NP_600083.1| hypothetical helicase [Corynebacterium glutamicum ATCC 13032] ['SF1', 'unclassified']
    MNTSPFTPGSPDLIDGLNEQQRAAVEHIGSPLLIVAGAGSGKTAVLTRRIAYLMRYRGVH
    PQQILAITFTNKAAAEMRERVSQLVGPVAERMWVATFHSVCVRILRQQAQLVEGLNTNFT
    IYDSDDSRRLLTMIAKDLELDIKKFSARTLLGAISNLKNELVTPQEALADAERTHNPYET
    VVARAFSEYQSRLRRANAVDFDDLIGETVRIFREHPPVAEYYRRRFRHVLIDEYQDTNHA
    QYELISTLVGKPDQDPSELCVVGDSDQSIYAFRGATIRNIEEFERDFSNARTILLEQNYR
    STQTILSAANAVISQNENRRPKNLWTALGEGEQIIGYVADNEHDEARFIASEIDNLVDHG
    MSYSDIAIMYRTNNSSRALEDVFMRTGVPYKVVGGTKFYERKEIRDIIAYLRVLENPDDT
    VNLRRIINTPKRGIGDRAQAFIALHSENNQISFGQALLDAALGKVDLLGARGKNAVIKFN
    ELFDALRSELPTMVNEVTGLPDIGQVISRILDITGYKAELEASNDPQDGARLDNLNELVS
    VAREFSSDAANRMVNEVPEGEAQPGSLQAFLERVSLVADADQIPDSDNGVVTLMTLHTAK
    GLEFPIVFLTGWEDGQFPHLRSLGDAKELAEERRLAYVGITRARKRLYMTRAMLRSSWGN
    PVTNPPSRFLQEVPAELIDWRREEPQMSSAWAPRPTRSIPTKTRTNNKQLDLSVGDRVNH
    DKYGLGTVLSSDGSGPRATVTIDFGSSGKVRLMLLGGVPMEKL
    
    • LLIVAGAGSGKTAVL [(31, 46)]
    • VLIDEYQDT [(228, 237)]
    • CVVGDSDQSIYAFR [(259, 273)]
    • ILLEQNYRS [(292, 301)]
    • TLHTAKGLEFPIV [(594, 607)]
    • EERRLAYVGITR [(630, 642)]

  32. gi|15889343|ref|NP_355024.1| hypothetical protein AGR_C_3725 [Agrobacterium tumefaciens str. C58] ['SF1', 'unclassified']
    MGRMSNSFDDMPFFDEEPVAPRRATNNAPSENGGGLGIAARAMAARDQVRPAHDYLSGLN
    PEQREAVETLDGPVLVLAGAGTGKTRVLTTRIAHILATGRAYPSQILAVTFTNKAAREMK
    ERIGVLVGGAVEGMPWLGTFHSIGVKLLRRHAELIGLKSDFTILDTDDVVRLIKQLIQAE
    GLDDKRWPAKQFAGMIDGWKNKGLTPPDIPEGDSRAFANGKGRELYAAYQARLKTLNACD
    FGDLLLHPISIFRRHTDILKEYHQKFRYILVDEYQDTNTAQYMWLRLLAQRAKDEPQNVC
    CVGDDDQSIYGWRGAEVDNILRFDKDFPGAKVIKLERNYRSTEHILGAAGHLIAHNEGRL
    GKTLFTERSSPDDEKVVVHAAWDSEEEARAVGEEIEQLQRKNYKLNDMAILVRASFQMRE
    FEDRFVTLGLNYRVIGGPRFYERLEIRDAMAYFRLVCQPADDLAFERIVNTPKRGLGDTT
    IRNLHDYARARDIPMLAAAADIIETDELKPKARKALFDVVQDFRRWQGLLENTEHTTLAE
    QILDESGYTAMWQADKTAEAPGRLENLKELIRSMESFESMRGFLEHVALVMDAEQNAELD
    AVSIMTLHSAKGLEFDTVFLPGWEEGLFPHQRALDEGGRSGLEEERRLAYVGITRAKKLC
    HIWFVSNRRIHGLWQSTLPSRFLDELPPAHVDVAASDSNYGGYGGRGGYGQSRFDKADPF
    TNNYSTPGWKRAQQNRSDATRDNWGTRSGHAVERIGYGESGPRTRTIDGELVAKSVADKP
    SKFFVGDRVFHLKFGNGNISAIEGNKLTINFDRAGEKRVLDGFVEKV
    
    • VLVLAGAGTGKTRVL [(73, 88)]
    • ILVDEYQDT [(268, 277)]
    • CCVGDDDQSIYGWR [(299, 313)]
    • IKLERNYRS [(332, 341)]
    • TLHSAKGLEFDTV [(605, 618)]
    • EERRLAYVGITR [(643, 655)]

  33. gi|16080398|ref|NP_391225.1| hypothetical protein BSU33450 [Bacillus subtilis subsp. subtilis str. 168] ['SF1', 'HelD-like']
    MNQQDKEWKEEQSRIDEVLKELEKKERFLETSAGGLKHDIIGLRKSFWEDVKVNFDDAHE
    AIETMASIKQQAELLSDREHNHRRMDQQLKRIHQLKKSPYFGRIDFIENGEEQAERIYIG
    LASCLDEKEEHFLIYDWRAPISSLYYNYSPGKAEYEVPGETIEGEMVLKRQFMIKNGTLK
    AMFNTDMTIGDEMLQEVLSHHSDTQMKNIVSTIQKEQNQIIRNEKSKILIVQGAAGSGKT
    SAALQRVAYLLYRHRGVIDAGQIVLFSPNFLFNSYVSSVLPELGEENMEQATFQEYIEHR
    LGRKFKCESPFDQLEYCLTETKGGDFPTRLAGITWKAGLSFQQFINEYVTRLSSEGMIFK
    NIIFRGQKLITKEQIQSYFYSLDQNHSIPNRMEQTAKWLLSELNKLEKKERRKDWVVHEA
    ELLDKEDYLDVYKKLQERKRFSESTFNDYQREQQLLAAIIVKKAFKPLKQAVRLLAFLDV
    TQLYLQLFSGWGGKFQHEKMDAIGELTRSAFTDNKLLYEDAAPFLYMQDLIEGRKKNTKI
    KHLFIDEAQDYSPFQMAYMRSIFPAASMTVLGDINQSIYAHTINGDQRMDACFEDEPAEY
    VRLKRTYRSTRQIVEFTKAMLQDGADIEPFNRSGEMPLVVKTEGHESLCQKLAQEIGRLK
    KKGHETIAVICKTAHQCIQAHAHMSEYTDVRLIHKENQPFQKGVCVIPVYLAKGIEFDAV
    LVYDASEEHYHTEHDRRLLYTACTRAMHMLAVFYTGEASPFVTAVPPHLYQIAE
    
    • LIVQGAAGSGKTSAA [(228, 243)]
    • LFIDEAQDY [(542, 551)]
    • TVLGDINQSIYAHT [(568, 582)]
    • VRLKRTYRS [(600, 609)]
    • PVYLAKGIEFDAV [(707, 720)]
    • HDRRLLYTACTR [(733, 745)]

  34. gi|16078247|ref|NP_389064.1| hypothetical protein BSU11820 [Bacillus subtilis subsp. subtilis str. 168] ['SF1', 'UvrD-like']
    MKCARLNDRIIHLHTYSREHYQFLFEEGIKGHLFCSHCGKPVLLRLNIADPPEFIHRQPG
    DFPACEEACEPKPSKEGKKEDDQESGVIRLPKGKAIAADPSPAVTEWHRPRSIKPGTPFV
    PKTIEPDTSLFPSVGLNTDQLKAVTETEGPLLVLAGAGSGKTRVLTARAAHMIEHLGIPP
    ENMLLVTFTTKAVAEMKERMANQYGLQPAKVRRIVTGTFHSLFYKILYHSNSAKWNGEHL
    LKMEWQREQYIKKALYEEGIDEKESPVDQALQQIGFWKNTYVPNERIPLKDEWEKQVYRL
    YEHYERQKKEHSQFDFDDMASACYELFIERPDLLEQYQSRFTYILIDEFQDINPVQYKIM
    QMLASPEQNLCCVGDDDQSIYAFRGSNPSFILDFQKDYPGAKTIYLTANYRSTHPIVSSA
    DIVVKKNKNRYAKTLEAARDDIQVPVLFYPYDEEEEATMVVSDIKEKIQNGASPEDFAVL
    YRTNSGGRAIYERLHQSSIPYTADRGVQSFYSRRIVRQILAYLYASQNEDDTEAIKHLLP
    ALFLKQSALNTLKALSITEDCTMIKALAKLPDLKPFQLDKIKKIVPFFASLRTMKPVEAI
    TFAEGKMGFSEYLKKRGNEGNKLEKGSDDLRDIKVVAKKFKTIPDFLAHVDHMRAAEKNR
    TDEHGVQLMTIHRSKGLEFKTVYVLGTVDGSIPHDFSLETARKGDEAALEEERRLLYVAM
    TRAKQHLYLSCPANRRGKTANRSRFLYPLLQKARQPLHH
    
    • LLVLAGAGSGKTRVL [(150, 165)]
    • ILIDEFQDI [(343, 352)]
    • CCVGDDDQSIYAFR [(370, 384)]
    • IYLTANYRS [(403, 412)]
    • TIHRSKGLEFKTV [(669, 682)]
    • EERRLLYVAMTR [(710, 722)]

  35. gi|25011258|ref|NP_735653.1| hypothetical protein gbs1209 [Streptococcus agalactiae NEM316] ['SF1', 'unclassified']
    MNPLIIGMNDKQAEAVQTTDGPLLIMAGAGSGKTRVLTHRIAYLIDEKYVNPWNILAITF
    TNKAAREMRERAIALNPATQDTLIATFHSMCVRILRREADYIGYNRNFTIVDPGEQRTLM
    KRIIKQLNLDTKKWNERSILGTISNAKNDLLDEIAYEKQAGDMYTQVIAKCYKAYQEELR
    RSEAMDFDDLIMMTLRLFDQNKDVLAYYQQRYQYIHVDEYQDTNHAQYQLVKLLASRFKN
    ICVVGDADQSIYGWRGADMQNILDFEKDYPQAKVVLLEENYRSTKKILQAANNVINHNKN
    RRPKKLWTQNDEGEQIVYHRANNEQEEAVFVASTIDNIVREQGKNFKDFAVLYRTNAQSR
    TIEEALLKSNIPYTMVGGTKFYSRKEIRDVIAYLNILANTSDNISFERIVNEPKRGVGPG
    TLEKIRSFAYEQNMSLLDASSNVMMSPLKGKAAQAVWDLANLILTLRSKLDSLTVTEITE
    NLLDKTGYLEALQVQNTLESQARIENIEEFLSVTKNFDDNPEITVEGETGLDRLSRFLND
    LALIADTDDSATETAEVTLMTLHAAKGLEFPVVFLIGMEEGVFPLSRAIEDADELEEERR
    LAYVGITRAEQILFLTNANTRTLFGKTSYNRPTRFIREIDDELIQHQGLARPVNSSFGVK
    YSKEQPTQFGQGMSLQQALQARKSNSQPQVTAQLQALNANNSHETSWEIGDVATHKKWGD
    GTVLEVSGSGKTQELKINFPGIGLKKLLASVAPISKKEN
    
    • LLIMAGAGSGKTRVL [(22, 37)]
    • IHVDEYQDT [(214, 223)]
    • CVVGDADQSIYGWR [(241, 255)]
    • VLLEENYRS [(274, 283)]
    • TLHAAKGLEFPVV [(560, 573)]
    • EERRLAYVGITR [(596, 608)]